SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1KFF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1KFF9
Domain Number - Region: 22-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00326
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1KFF9
Sequence length 169
Comment (tr|B1KFF9|B1KFF9_SHEWM) Uncharacterized protein {ECO:0000313|EMBL:ACA88134.1} KW=Complete proteome; Reference proteome OX=392500 OS=Shewanella woodyi (strain ATCC 51908 / MS32). GN=Swoo_3876 OC=Shewanellaceae; Shewanella.
Sequence
MDRSFPEILKKLHEIEIDYADGEGIDFEPFDEFYSEEETSDWIKAWTGNDTLDGNEYLIY
GQDGTGGYVAFWCVRKNADLLEQPIVFFGSEGEVGVVAQSFSDYVWLFANGIGPYEAVAY
PDLERPKSQDFIRFATEYAPSSKSTASQIVEKAKAEFPDFEGIIDRLCQ
Download sequence
Identical sequences B1KFF9
WP_012326464.1.77901 392500.Swoo_3876 gi|170728203|ref|YP_001762229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]