SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1KFN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1KFN7
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-42
Family SMI1/KNR4-like 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1KFN7
Sequence length 133
Comment (tr|B1KFN7|B1KFN7_SHEWM) Uncharacterized protein {ECO:0000313|EMBL:ACA85203.1} KW=Complete proteome; Reference proteome OX=392500 OS=Shewanella woodyi (strain ATCC 51908 / MS32). GN=Swoo_0909 OC=Shewanellaceae; Shewanella.
Sequence
MHDIIEQLQEMSETVPIPLELPTFDQLVMAEEEILMPLPGELKQYLLYASDVIYGSLEPV
TVSDPNSHTFLPEVTAYAWSIGMPREYVAVCQQGNSFYCIDQEGQMLLWNEDGSESEYWE
SLWEWVEQVWMKS
Download sequence
Identical sequences B1KFN7
392500.Swoo_0909 WP_012323550.1.77901 gi|170725272|ref|YP_001759298.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]