SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1KH38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1KH38
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.46e-19
Family SMI1/KNR4-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1KH38
Sequence length 186
Comment (tr|B1KH38|B1KH38_SHEWM) Uncharacterized protein {ECO:0000313|EMBL:ACA88350.1} KW=Complete proteome; Reference proteome OX=392500 OS=Shewanella woodyi (strain ATCC 51908 / MS32). GN=Swoo_4094 OC=Shewanellaceae; Shewanella.
Sequence
MSKDISELCAKIKWKPIDTDYGATKESYLSSNEELIAIERFLQAKLPDDYLWFMKNVGRR
LIDDRRINIKLNGVSLSFLDWFRDAIDVLTFTQMASEKEDKMQTSFNLVVISSSISHDEV
LLDVSAGHYGNIWFKHHNPKWRQKFSENPEGLVLIANSFTDLFSKIVNNHSPGEIDFNFD
DDDEII
Download sequence
Identical sequences B1KH38
gi|170728419|ref|YP_001762445.1| WP_012326679.1.77901 392500.Swoo_4094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]