SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1KPX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1KPX6
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.37e-28
Family SMI1/KNR4-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1KPX6
Sequence length 144
Comment (tr|B1KPX6|B1KPX6_SHEWM) YobK {ECO:0000313|EMBL:ACA87659.1} KW=Complete proteome; Reference proteome OX=392500 OS=Shewanella woodyi (strain ATCC 51908 / MS32). GN=Swoo_3391 OC=Shewanellaceae; Shewanella.
Sequence
MYISKLNNREGLWLAGGASLGLVSNLEEALGVILPETYKEFLLELGSLSIGDISISGITC
ENLDDGGGSVLSDTLYFQRDYDLPENLIVIQPDEDAPYCLDTTDKNSVGEMSVVCFEIQS
GEQNQIADNFQDWFFRYFLTNINR
Download sequence
Identical sequences B1KPX6
gi|170727728|ref|YP_001761754.1| 392500.Swoo_3391 WP_012325994.1.77901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]