SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L381 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L381
Domain Number 1 Region: 13-91,176-347
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.88e-85
Family Pyruvate kinase 0.00000954
Further Details:      
 
Domain Number 2 Region: 333-473
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.83e-31
Family Pyruvate kinase, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 86-169
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000698
Family Pyruvate kinase beta-barrel domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1L381
Sequence length 491
Comment (tr|B1L381|B1L381_KORCO) Pyruvate kinase {ECO:0000256|RuleBase:RU000504} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_0150 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MASITFSFYCIISPMPMQKTKIIATIGPSSSQIEVLKGMIAEGMSIARLNFSHGTIGEKM
EQIEVIRRASYELGIRLGLMSDLQGPEVRTHMGKKELKIEDGDLVTVSGKEGIGEIKIKP
SSVLRGLEPDDELYIDEGRIRLRVREVDGELLKCEVIQGGLVRDKRSVHASKPFELRGLT
EEDKEAIKASISKGVDFIALSFVKSAEDVTEAMEFMRSISEEPPAIISKIETKEAVERIR
EILDVSYGIMVARGDLGVELPLQEVPKIQKKLIRLANQNAKPVITATEMLESMTQSPIPT
RAEVTDVYNAILDGSDAIMLSAETAIGKYPVLSVRWMRIIAEMAESSLESRLDFPVDNIP
SFIGKAAVEASEILKCPVIFCFTYSGYTARHVARHRPKARIIALSSNKRTSQLLTLTWGV
ETIDVTGDLDEALSYALSYCMDRGILSEEDRIVVTYGHPHGEAKTNTLRILSVRELQRAG
TPKPSEITGPS
Download sequence
Identical sequences B1L381
gi|170289777|ref|YP_001736593.1| WP_012308807.1.97847 374847.Kcr_0150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]