SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L383 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L383
Domain Number 1 Region: 80-233
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.19e-27
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 8.6e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1L383
Sequence length 263
Comment (tr|B1L383|B1L383_KORCO) Oxidoreductase FAD/NAD(P)-binding domain protein {ECO:0000313|EMBL:ACB06912.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_0152 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MRIIESEKLSEKVKKIVLEGNLGSSPGQYAMIWVPKVGEIPISIAREPKGETWILVAKVG
KVSSAIHSLRIGEELWVRGPYGRGFSLRGGKCCLIGGGYGIAPLISLSERLGEMGNAKIR
FYAGFKRREDVLLEDLLSSISDELIITTEDGSYGLKGRVVELVDFDWPEAIYSAGPEAML
VEVVREAIKRGIYAEVSMERLIRCSIGICGSCSLDPLGLLVCRDGPVFDARTLSMTEDFG
RYWRGFDGRKLQIGGESIGMLLR
Download sequence
Identical sequences B1L383
gi|170289779|ref|YP_001736595.1| 374847.Kcr_0152 WP_012308809.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]