SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L6T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L6T4
Domain Number 1 Region: 7-99
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000536
Family Prefoldin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1L6T4
Sequence length 106
Comment (tr|B1L6T4|B1L6T4_KORCO) Prefoldin beta-domain protein {ECO:0000313|EMBL:ACB08163.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1417 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MSSDEYLQAKAEEILAELNQVLVQLATLRAEYNSVDEAIRRLERLPEADEIFERVGVLYI
RRDRDSVLLDLKATKETLEATIKSLEKKERDLRETLSRVASSTQSS
Download sequence
Identical sequences B1L6T4
WP_012310060.1.97847 gi|170291030|ref|YP_001737846.1| 374847.Kcr_1417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]