SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L6U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L6U1
Domain Number 1 Region: 10-349
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.58e-52
Family tRNA pseudouridine synthase TruD 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1L6U1
Sequence length 359
Comment (tr|B1L6U1|B1L6U1_KORCO) Pseudouridylate synthase {ECO:0000313|EMBL:ACB08170.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1424 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MEVPPIDSHLGMLTYMSGGSPINGRLREKLSDFIVDEVLLGKRASRAFLGIDKFEGGGVS
YLVVMKRVRMDSFEMISKLSKKLGRRVGYAGMKDARSISFQFISVQGSLRELPEMEGLSL
RYAGRGEMIYLGMNDGNHFTVVIRGADTIELPKIFPNFFSYQRFGVKRPYNHEIGKAILL
RDIEGASSMISEQGYEVSAARSLKQLSEMIGSELIRFYVHSYQSYIFNLILSRRIELGID
PRHGDFVLRPNGEIALYPERGSLLLPLVGGLTEARGWLAEELASILREEGVSKEMFIFRE
LPEVSALGDFRKAFCEVEPKIVEREGFIVLSFFLESGAYATSYLREIIKPRDPIAQGFI
Download sequence
Identical sequences B1L6U1
WP_012310067.1.97847 gi|170291037|ref|YP_001737853.1| 374847.Kcr_1424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]