SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L6V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1L6V0
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Prefoldin 0.00889
Family Prefoldin 0.013
Further Details:      
 
Domain Number - Region: 71-185
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00994
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1L6V0
Sequence length 245
Comment (tr|B1L6V0|B1L6V0_KORCO) Uncharacterized protein {ECO:0000313|EMBL:ACB08179.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1433 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MRGKVSGYLLSSLKEYFGDEKGEKIAEILSRSNIRCFDDLSTDIPDSLIELMEVSKSSFR
NFLEEYGPQAIAKLKERVEDLSSKVKQLETQIGWAKERIQQSIDFRSSTSLRAMRELDVA
IGILSSIVSSIQICCEKSSGIDERKAEIYSKTINEAAERLRRASDSDEEFSEQLKDAASS
LERIVEIMRELRAGDLLDLLNYTLSILSDIKRTRMRLDFDKNSLILENILLKSKIVSLLC
SRFNP
Download sequence
Identical sequences B1L6V0
gi|170291046|ref|YP_001737862.1| 374847.Kcr_1433 WP_012310076.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]