SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1L758 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L758
Domain Number 1 Region: 110-350
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000000000186
Family Terpene synthases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1L758
Sequence length 793
Comment (tr|B1L758|B1L758_KORCO) Uncharacterized protein {ECO:0000313|EMBL:ACB08287.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1541 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MLRKSSLLLIILLLSSCASMGQDSRGIIERAVEEPMKSVSSVPDFKSISEVPRGSYGYVN
GVLYVDKSGFTFGAIPDLEFNIYAALILGEALQAYNFASLNPSSVSNARARLSSIASWLS
QQAIDGLWGSDISGKLADVYFSSLAIRAISLAISSGSLPKDKLSSLSSSVSRMISLQDEG
GGWGRIPQADVFQMKQPTPSVTASVLKALLSAREAGLRVPDSSINKALNYLAATASRSGN
MVYWEESGSKALYVTGEVGDAIAEALYQGYSFDESMIRGLINYLDASVRQSYSAGTYDFM
TASALNVLSKLSSLGYLETDKLVSNYGAIMVDLANTIRPDGLFTDFPYIWLRYSYTYPYV
AVFTNWLRITSVSSNAYFVGGYGDYQPTVLVEGTSLNLKVSVSNKISKPLSLIMSVRAGP
PASISGSSEAKFTLEAGKDREFTFKINAPDGLPSPQNVSVSILLREANSSKPIFAKSLPL
RLLRNSVLNLESKVASPISSQLRKPVNITLTFSNRGDLPITDLTFVEKLSSGFELVTTFP
GNGTALVTSTNSLGSYVMPQPLAPGSKMTLVYQVTPVDAPPGPQTVSTTFITYTDARGER
HNLSKDVKITVLRPYLLISSNVSSLKMEWDEEKMILIALSNVGNEDATEVSLKMASGEGL
SLNLSMIPKEVMYRPNPDGSLLLRIDKVASGTTITIPVRVKATNFYPSPELGTFLSVSYE
YKDSIGRTMPGYSGSNIVKVTLSVSKTFLYIVSALIIVLAVLIAIRIKNRVKSTRRSPLL
IERRKRGRIPFES
Download sequence
Identical sequences B1L758
374847.Kcr_1541 gi|170291154|ref|YP_001737970.1| WP_012310184.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]