SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1P838 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1P838
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-22
Family Duffy binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1P838
Sequence length 129
Comment (tr|B1P838|B1P838_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:ACA30365.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DTGDIIRGKDLYRGYDEKEKNRRDKLEDKLKEVFGNIYNELTTSGKNGEAAKNHYEDDTK
NYYQLREDWWDANRETVWKAITCNAGGSQYFRATCGDSGRPSMAKNNCRCEGTNVNIVPT
YFDYVQYLR
Download sequence
Identical sequences B1P838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]