SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1WBH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1WBH3
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.71e-24
Family Hormone receptor domain 0.00053
Further Details:      
 
Domain Number 2 Region: 114-390
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000915
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1WBH3
Sequence length 435
Comment (tr|B1WBH3|B1WBH3_XENTR) LOC100145780 protein {ECO:0000313|EMBL:AAI61755.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC100145780 OC=Silurana.
Sequence
MENLVYMLVLMVPFLLPVHGFHPECRMKLALKQQEMKCMAKLKAQATEISSEKGCIGIWD
NITCWDTARHGEKVTQNCPVALRHILRKQGNITRTCKRTGWTDIYPDIVEACGYNDSEPM
KLNFYIIVQTIYTFGHSVSLIALTIGSTILCLFRKLHCTRNYIHLNMFISFILKAISVLI
KDGFLFSNPESCPESLIGCKVILVLMQYCVMANFYWLLVEGLYLQTLLVVIFTSHKLFIV
YLLIGWGIPTIFIIIWIVSRVYLDDTECWDTNDHSVPWWIIRIPIIISITLNFCLFINII
RILLQKLLSPDVGGNDQSQFKRLAKSTLLLIPLFGVHYMVFVGFPMPSFSDCQIWFELCV
GSFQGLVVAILYCFLNTEVQGELKRKWRSLDYIRYKKHDKRMHSLTISRNGSEGVPQFHR
DSRAQSIMQTETTMI
Download sequence
Identical sequences B1WBH3
ENSXETP00000062521 gi|171847176|gb|AAI61755| gi|187607730|ref|NP_001120616| NP_001120616.1.99540 ENSXETP00000062521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]