SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1Y092 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1Y092
Domain Number 1 Region: 8-292
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.39e-62
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1Y092
Sequence length 310
Comment (tr|B1Y092|B1Y092_LEPCP) 40-residue YVTN family beta-propeller repeat protein {ECO:0000313|EMBL:ACB35373.1} KW=Complete proteome; Reference proteome OX=395495 OS=discophora (strain SP-6)). GN=Lcho_3113 OC=Leptothrix.
Sequence
MSQPAAAAPFAYVTNQGSHDVSVIDLADPRTIARVPVGQSPAGVVAASARGEVFVANAAG
NSISVIDMRSQQVVDTFAAGQGAVGLDASADGRRLFVVDWYGAALRVFDASTRRQIAHVP
LGPAPAGVAALPDGSAAWVAERDDDRVALIDVARAQVVARVAVGSHPFALLLDSARERLY
ALNVQSDSVSVIDTRSRQVIATLPTGRAPYGAVLADGARLLYVTNQHDDSVSVFDAQSLK
PLRTLGGFGYPEGIAASGERVYVVNWMDDQLSVLDAASGRLLATLATGRNPRGFGAFIGT
PPPHPRSPDE
Download sequence
Identical sequences B1Y092
WP_012348124.1.27902 395495.Lcho_3113 gi|171059789|ref|YP_001792138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]