SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1Y2E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1Y2E9
Domain Number 1 Region: 8-283
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.32e-68
Family Carbon-carbon bond hydrolase 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1Y2E9
Sequence length 289
Comment (tr|B1Y2E9|B1Y2E9_LEPCP) Alpha/beta hydrolase fold {ECO:0000313|EMBL:ACB35602.1} KW=Complete proteome; Reference proteome OX=395495 OS=discophora (strain SP-6)). GN=Lcho_3344 OC=Leptothrix.
Sequence
MSQQQSPTAANPEIGQRIRTGAFHSNVHDLGRAHPGQPPVLLIHGSGPGVSAWANWRLVM
PVLAQDRRVIAPDMVGFGYSDRPEGITYSMDTWVQQAIDLLDALDLPQVDLIGNSFGGAL
ALALAIRAPQRVRRLVLMGSVGVPFELTPGLDAAWGYQPSIEAMRHLLDTFAFSRKLVTD
ELAQLRYQASIRPGFQESFSAMFPAPRQQWVDAMASPEAAIRALAHETLIVHGREDQVIP
LQTSLTLSQWIPNSQLHVFGHCGHWTQIEHSARFAQLVSNFLAEADTPA
Download sequence
Identical sequences B1Y2E9
gi|171060018|ref|YP_001792367.1| WP_012348349.1.27902 395495.Lcho_3344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]