SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1Y8G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1Y8G6
Domain Number 1 Region: 16-201
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.79e-19
Family Carboxylesterase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1Y8G6
Sequence length 207
Comment (tr|B1Y8G6|B1Y8G6_LEPCP) Uncharacterized protein {ECO:0000313|EMBL:ACB36232.1} KW=Complete proteome; Reference proteome OX=395495 OS=discophora (strain SP-6)). GN=Lcho_3978 OC=Leptothrix.
Sequence
MASGGADACAVGVTHLLYLHGFRSSPQSFKARRMADWMRTHRPDVQWWCPQLPPSPQAAA
ERLLDGVKDWPADRSAVIGSSLGGFYATVLAERLGWPAVLINPAVEPARDLARHIGEQTS
WHDPQDHFFFRAEFIDELRALRPAALSRPQRYLAVIAKGDEVLDWREMQARYADTQIRLI
DGSDHALSDFDIHLPQILQFLGLDRAA
Download sequence
Identical sequences B1Y8G6
395495.Lcho_3978 WP_012348977.1.27902 gi|171060648|ref|YP_001792997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]