SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1YB68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1YB68
Domain Number - Region: 16-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0152
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1YB68
Sequence length 62
Comment (tr|B1YB68|B1YB68_PYRNV) Uncharacterized protein {ECO:0000313|EMBL:ACB39199.1} KW=Complete proteome OX=444157 OS=(Thermoproteus neutrophilus). GN=Tneu_0246 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MEIPQELKSYLAVEADQWDVKHIVCLKCRKKFFTVRDAALHLHAVHGLKAAQKYISASHG
QA
Download sequence
Identical sequences B1YB68
gi|171184726|ref|YP_001793645.1| 444157.Tneu_0246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]