SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1ZU98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1ZU98
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000341
Family Intron-encoded homing endonucleases 0.013
Further Details:      
 
Weak hits

Sequence:  B1ZU98
Domain Number - Region: 67-146
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.0275
Family N-terminal domain of cbl (N-cbl) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1ZU98
Sequence length 203
Comment (tr|B1ZU98|B1ZU98_OPITP) Uncharacterized protein {ECO:0000313|EMBL:ACB76660.1} KW=Complete proteome; Reference proteome OX=452637 OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1). GN=Oter_3383 OC=Opitutus.
Sequence
MASSAVRYFERAAGDARDAVAVQARTKIGLAPDRVRALLEASRPLTPEEARRAMVRQVRP
KSCGRTGLPRYAVELMYADYKRLRSLSKTGRLHARTRQSMYQIFQAHGLPLYERRFQRKI
RFAGREFTPGKDGYYRATSGDRRQLHYVIWERANGPVPAGHQVTFKNADKRDFRIENLAC
MPIRDVTLFHHARHTAAKDRAKP
Download sequence
Identical sequences B1ZU98
452637.Oter_3383 gi|182415194|ref|YP_001820260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]