SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2A413 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2A413
Domain Number 1 Region: 112-163,358-565
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.84e-45
Family Bacterial dinuclear zinc exopeptidases 0.0028
Further Details:      
 
Domain Number 2 Region: 217-295
Classification Level Classification E-value
Superfamily PA domain 0.0000262
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2A413
Sequence length 571
Comment (tr|B2A413|B2A413_NATTJ) Peptidase M28 {ECO:0000313|EMBL:ACB85115.1} KW=Complete proteome; Reference proteome OX=457570 OS=JW/NM-WN-LF). GN=Nther_1537 OC=Natranaerobius.
Sequence
MRFTVESSLSITKLFFILLIAVLITVKLTGCGDHGYMVFLNLEPEEAGEVSGSGTYEQGE
EITVSVDTGESWEFIGWFEDGEKVSKEQEYTFSVTESRNLVAEMKPGEGEVIQGYIEDLL
EIGPRPPGSEAEKEAALFLKDVYRDLGYDEEGYELELQEFKLSEQTGFEDLKGPENMKLA
DISVMDGEEHFGNVSAELADQSWTYEKYHDTVWQAMTSPHGETASVEGEMYYSGTGMEEG
DFPEEVDGNIALIKVDDTEVEWEFNEDLNLRTFEISEQQIENAKEAGAEAVIFTFLDDEH
HQGNTEAQTMVPLIQDKEGKEKEVNIPILGASSIHGQWLQEMEKEHANPPELEISSYKNI
DLKSYNVVATKKSDKEDAPIITVTAHLDSVPGSPGASDNASGTTTLLKLAESLKNKDLDA
ELRFANLGAEEVGLFGAYHYVEQLSEEELENHYNINPDMIGTSYPKNDELFITSLDQSEN
EVTNSLLEGQEILDYDVATFDAQVNINSDHVAFDDKGIPAVCLVWMGERGLEPVYHTPLD
TVEDNISAKRLNLAYDIIKEGIIQLDERIQD
Download sequence
Identical sequences B2A413
gi|188586158|ref|YP_001917703.1| 457570.Nther_1537 WP_012447985.1.10671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]