SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2BJ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2BJ26
Domain Number 1 Region: 53-112
Classification Level Classification E-value
Superfamily DNA-binding domain 2.55e-21
Family GCC-box binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2BJ26
Sequence length 224
Comment (tr|B2BJ26|B2BJ26_ARATH) C-repeat binding factor 4 {ECO:0000313|EMBL:ABV27156.1} OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=CBF4 OC=Arabidopsis.
Sequence
MNPFYSTFPDSFLSISDHRSPVSDSSECSPKLASSCPKKRAGRKKFRETRHPIYRGVRQR
NSGKWVCEVREPNKKSRIWLGTFPTVEMAARAHDVAALALRGRSACLNFADSAWRLRIPE
TTCPKEIQKAASEAAMAFQNETTTEGSKTAAEAEEAAGEGVREGERRAEEQNGGVFYMDD
EALLGMPNFFENMAEGMLLPPPEVGWNHNDFDGVGDVSLWSFDE
Download sequence
Identical sequences B2BJ26 Q9FJ93
AT5G51990.1 AT5G51990.1 3702.AT5G51990.1-P NP_200012.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]