SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2HJ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2HJ05
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.88e-63
Family Carbon-carbon bond hydrolase 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2HJ05
Sequence length 295
Comment (tr|B2HJ05|B2HJ05_MYCMM) 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BphD {ECO:0000313|EMBL:ACC43468.1} KW=Complete proteome; Reference proteome OX=216594 OS=Mycobacterium marinum (strain ATCC BAA-535 / M). GN=MMAR_5064 OC=Mycobacterium.
Sequence
MTVTQSKTAEHTFESTSRYAEVDVDGPLKLHYHEAGVGNDQTVVLLHGGGPGASSWSNFA
RNIEVLAQQFHVLAVDQPGYGHSDKRAEHGQFNHYAARALKELFDQLGLGRVPLVGNSLG
GGTAVRFALDYPDRAGRLVLMGPGGLSINLFAPDPTEGVKRLGKFSVAPTRENLEAFLRV
MVYDQKLITPELVDQRFELARTPESLAATRAMGKSFAAADFELGMMWREVYKLRQPVLLI
WGREDRVNPLDGALVALKTIPRAQLHVFGQCGHWAQVEKFDEFNRLTIDFLGGAR
Download sequence
Identical sequences B2HJ05
216594.MMAR_5064 WP_012396587.1.28311 WP_012396587.1.48473 WP_012396587.1.90902 WP_012396587.1.91103 WP_012396587.1.92715 gi|183985032|ref|YP_001853323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]