SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2IU91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2IU91
Domain Number 1 Region: 43-234
Classification Level Classification E-value
Superfamily ARM repeat 1.8e-39
Family PBS lyase HEAT-like repeat 0.043
Further Details:      
 
Domain Number 2 Region: 420-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000372
Family Nitrogenase iron protein-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2IU91
Sequence length 824
Comment (tr|B2IU91|B2IU91_NOSP7) PBS lyase HEAT domain protein repeat-containing protein {ECO:0000313|EMBL:ACC79662.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_R0930 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MIQSDSMTKHTRQVLLSALKVVVLCLTLFLLCTSNSWAQITTDSKIAPLIEKLIDNDAHI
RSLAADALVNIGSPAVPSLIEALKNQDINLRWHAASVLGDLGAEAAPAVSALSAALQDED
GQVRLYATLALGNIGTAAKAAVPSLMAALQDKEQFVRIYVPSALRKIGVEAKVAVPVLTA
ALKDKNPTVRYNSAYALGAMGTEAVSSVPNLIALLNDNQFYVRLGAIKGLGGIAAGFQDK
ANALPTSKLQKVISDFEQVLATIQKYKDKFTETDIRLIRRPLNALKAEKETRLFDRVLES
LFKHKLLLGIAAYLILLPSIWLILLRVAPLWLLKINNALKPYTDFSLPFISVNVPLRYVL
FVGWFHYHPRVLDAWVAKYIKAAREQFPKKDTVNSRACYIPIPVVLDSTTVPQLMNENLR
STFEKQRSCLVIGGEGGVGKTSLACRIAGWAMAEAEDQQLCKHLMLPVLLEEEFRVTEGK
SPLLEAIRGQLQALIDEPEPICQELLLRLLRKKRILVIVDRFSEMNATTREAIEPESPEF
PVNALVITSRIEEKLGRVNKTIIKPLRIEANKLSSFMEAYLMQRGKRDRFTDQEFFDACN
RLSLMVGQNNITVLLAKLYAEQLIASKDVTSNISALPENIPNLMLGYINELNRDVTDNQF
DDRTVHQDAKAIAWECLQQSYQPATAKRADAIAALAALGIDDPEAHLNYLEKRLHLIQTI
GSAKDRIRFCLDPLAEYLAGWYLIELYGNNDGKWRSHFFKKADDLVKTGAPDAIKGLLLA
VQDCYLSEIQGSKETDFVPQKSGKLAGFTPSINIPATTVQTPIP
Download sequence
Identical sequences B2IU91
gi|186681409|ref|YP_001864605.1| 63737.Npun_R0930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]