SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J0P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J0P9
Domain Number 1 Region: 5-227
Classification Level Classification E-value
Superfamily ARM repeat 1.4e-19
Family Armadillo repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2J0P9
Sequence length 232
Comment (tr|B2J0P9|B2J0P9_NOSP7) PBS lyase HEAT domain protein repeat-containing protein {ECO:0000313|EMBL:ACC80266.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F1581 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSNQQEQYNIDFLVQQLRTSQDNAVLKQTAKHLGFLGANNPDVIAALIHVARTTIDEPTR
WAAIQSLSEIGTDNNDVIQTLIEQLNTARIPTRRIAAQNLAKIAVGNQYAITSLISLAQI
TEEEHTRQYVAYSLGIIAKGNRDAVNALIDLIYKSSDEYTHYLCVDAFTKLGKWNKEIID
ALIHIGKTAEFYIRSKLLQTLKARGININGYTSNSSFRLLLEQMKEENNQTE
Download sequence
Identical sequences B2J0P9
WP_012408284.1.44837 63737.Npun_F1581 gi|186682013|ref|YP_001865209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]