SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J476 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J476
Domain Number 1 Region: 72-284
Classification Level Classification E-value
Superfamily ARM repeat 1.23e-44
Family PBS lyase HEAT-like repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2J476
Sequence length 301
Comment (tr|B2J476|B2J476_NOSP7) PBS lyase HEAT domain protein repeat-containing protein CpeF {ECO:0000313|EMBL:ACC82188.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F3804 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MLDSKTQSGEDSLHLSQAETDAILATVNEQLGLKSFNPDDQELLKQMIESMGDARGMVRL
SFAEALGKVGKPATPLLMEAVANHPNPVVRRASAKTLTLIADPIAVPTLVNALLNDEDTV
VKTSAVGGLAKIGEAAVPALLKILASTEYPESAKGHAVWALGFIGAEAKEHLYREINSDS
ADVRAAVVGAIAKIAEEGTEEGAFHILVNALTDSSLMVRCEAASALGSLAYQPAIPNLVE
LLHHADWETRKAAALALMKIGDRAALEPLQAALTKEEEAGVQAVIKLAMSQIERQLEEDS
W
Download sequence
Identical sequences B2J476
63737.Npun_F3804 WP_012410159.1.44837 gi|186683935|ref|YP_001867131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]