SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J4C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J4C6
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily ARM repeat 2.26e-21
Family PBS lyase HEAT-like repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2J4C6
Sequence length 241
Comment (tr|B2J4C6|B2J4C6_NOSP7) HEAT domain containing protein CpcF {ECO:0000313|EMBL:ACC83616.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F5295 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MNNSDLAQILIRAVQEADSSERLVDAVQELAAAGIEESVPTLIAALGYNNPGAAVAAVDG
LIAIGEAAVSPLLELIDDYNYGARAWALRALAGIGDVRALDTLFEAAKTDFSLSVRRAAA
RGLGTLRWHQVPAEKLESIQTEVLEALLLISQDPEWVVRYAAVTSLETLAIAIAVTLPDQ
ASRITNQLQQLLDTDADLGVRTRVKFAQQKIQQQQHQEVFAPKRKLQETEVEVPHRGGGR
R
Download sequence
Identical sequences B2J4C6
gi|186685363|ref|YP_001868559.1| 63737.Npun_F5295 WP_012411567.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]