SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J692 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J692
Domain Number 1 Region: 350-687
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-47
Family Patatin 0.0000614
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.65e-28
Family Laminin G-like module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2J692
Sequence length 698
Comment (tr|B2J692|B2J692_NOSP7) Patatin {ECO:0000313|EMBL:ACC80792.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F2191 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MINLVNTQTVLTFDGEKDYIDFGRNDIGGVFAQGSSAFTVSGWVNPHELTNKATSYGTRN
VFFARSSERYSDNFEFGISETGSLDVYIDESVSKGIKTFGQGELTIGQWHFFAIVFNSSQ
LTVYLDDREYSDSLRGLSLNKATSSITLGATLHKQVYFKGQLANISVWNYPCTQAQIQTH
RCGLIAGDEEGLVAYWKLDEGQGTTVKNQTGKSYQGNFRGNPIWTLAEIPFATQSSNPVP
FVGELSNQEDIKEEIQTETAVIPEENISPLTTNLLAATVSLVSDDENQPKKIQQTGINSE
ESEIIPTAIALSPHDEETKTHQAEDPVNIQQAQILTQEESVEAMNTKAHPKYKILSIDGG
GIRGIIPALLLAEIERRTQKPIFSLFDLITGTSSGGILALGLTKPRLSSDVSDNLPVAEY
TAEDLLQLFLEYGVEIFYEPLFERLLGPLEDIFLQPKYPSEGKEEIFRQYFGNAPLENNL
KEVFVTSYDLEQRIPIFFTNQPEKQQIESKNFQKLCGGFSLLDAALATSATPTYFAPHRL
VNPHNSGIAYTLIDGGVFANNPAHLAILEAQISSKRKAQKVLNTEDILVVSLGTGSLTSV
YPYKEVKNWGLLQWGRPLLNIMFDGGSEVVAGELEQLFEPSDQEAKSFYYRFQTLLDSEL
EEIDNTKLQNTRQLQAIAHRLISNKSQQIDEMCSLLLG
Download sequence
Identical sequences B2J692
63737.Npun_F2191 WP_012408793.1.44837 gi|186682539|ref|YP_001865735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]