SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J6S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B2J6S4
Domain Number - Region: 192-227
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000137
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2J6S4
Sequence length 228
Comment (tr|B2J6S4|B2J6S4_NOSP7) Uncharacterized protein {ECO:0000313|EMBL:ACC83850.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F5545 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSSLSNIGNLMHLYLDEIDPGEGTNAPEFLIKASAHLLNQKEGRNWIPVIVKETGKDKYQ
VIANSFIYAIAEAARLDRVWCIITDGSDETVEVTKVLAKEEIPKINLSKASRDEIMAALE
YLVEQPGSVLKAVKPAIATNRIDEAPREYWKTLDPILNLKCGITKGKKLDALNKVFYLTP
QPMPDTITDTAILQTMTIADLKAIAKKRGITGITKMKKDNLVKALSKP
Download sequence
Identical sequences B2J6S4
gi|186685597|ref|YP_001868793.1| WP_012411794.1.44837 63737.Npun_F5545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]