SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2J9I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J9I7
Domain Number 1 Region: 7-215
Classification Level Classification E-value
Superfamily ARM repeat 2.93e-28
Family PBS lyase HEAT-like repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2J9I7
Sequence length 220
Comment (tr|B2J9I7|B2J9I7_NOSP7) HEAT domain containing protein {ECO:0000313|EMBL:ACC79486.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_R0734 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MEIDQIQTELKNPDFHSRLKAIAALNDYESEVAVPLLASKLHDSEFLVRSFVTRGLGNQQ
SAESFAALMQIMKFDDTPNVRAEAANSLSLFGRVAVSHLVMAFYQDDHWLVKRSILAAIA
EMNCPEELFDICVQGLKDEDFTVQESSVDGLSLLADSSQHTAALSQILTLVNDESWRMRV
RVSYALKRFDEPEAKAALNQLRQDEDHRVVGAALEDLLPQ
Download sequence
Identical sequences B2J9I7
gi|186681233|ref|YP_001864429.1| 63737.Npun_R0734 WP_012407511.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]