SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2KGF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2KGF0
Domain Number 1 Region: 5-226
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.28e-62
Family D-ribulose-5-phosphate 3-epimerase 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2KGF0
Sequence length 235
Comment (tr|B2KGF0|B2KGF0_MOUSE) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_121562 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRSVFLHFVPNITFGHPV
VESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGM
KVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIE
VDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences B2KGF0
ENSMUSP00000109628 NP_001297571.1.92730 ENSMUSP00000109628 10090.ENSMUSP00000109628 ENSMUSP00000109628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]