SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ZC35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ZC35
Domain Number 1 Region: 43-261
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.59e-120
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000372
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 3.3e-18
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2ZC35
Sequence length 261
Comment (tr|B2ZC35|B2ZC35_9ARCH) Methyl coenzyme M reductase subunit alpha {ECO:0000313|EMBL:ACD35185.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFIAAYRMCAGEAAVADLSFAAKHAGVVQMASLLPARRARGPNEPGGIKFGLFA
DIVQANRKYPNDPAKAALEVVGAGTMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDEFT
YYGMDYVKDKYNVDWKNPSESDKVKPTQDVVNDMATEVTLNAMEQYEQFPTMMEDHFGGS
QRAGVIAAASGLTTAIATGNSNAGLNGWYLSMLLHKDGWSRLGFFGYDLQDQCGSANSLS
MEPDRGLMGELRGPNYPNYAM
Download sequence
Identical sequences B2ZC35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]