SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3KTW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3KTW5
Domain Number 1 Region: 129-209
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 40-106
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000877
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 411-459
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000119
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3KTW5
Sequence length 464
Comment (tr|B3KTW5|B3KTW5_HUMAN) cDNA FLJ38871 fis, clone MESAN2013611, highly similar to Homo sapiens ring finger and KH domain containing 2 (RKHD2), mRNA {ECO:0000313|EMBL:BAG53227.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MMAAMLSHAYGPGGCGAAAAALNGEQAALLRRKSVNTTECVPVPSSEHVAEIVGRQGCKI
KALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALG
GLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTG
MPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNPVPPSR
ARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVD
SPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHP
LARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENE
VIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Download sequence
Identical sequences B3KTW5
XP_003926111.1.74449 XP_005586731.1.63531 XP_008529039.1.77740 XP_010375090.1.97406 XP_011784147.1.43180 XP_011784148.1.43180 ENSMMUP00000031136 ENSMMUP00000031136 9544.ENSMMUP00000031136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]