SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LIC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LIC9
Domain Number 1 Region: 475-520,589-613
Classification Level Classification E-value
Superfamily PH domain-like 0.00000214
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Weak hits

Sequence:  B3LIC9
Domain Number - Region: 252-450
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0335
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3LIC9
Sequence length 1146
Comment (tr|B3LIC9|B3LIC9_YEAS1) Protein ASK10 {ECO:0000313|EMBL:EDV10150.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_00920 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSDYFSSRPSQTLTPMGNKPSGGGGGDDASSIHSKSSQYLMDILPDSMTLNESVSSIVAN
NQAKEFILPETDERSPYFINVPIPKAQPTSTTETKKPLAGDEAIDGQFVKEYPTDILVDR
FYKWKKILKGLVIYLREVAYAQEQFARINYQLKGSVKFPFLTDIDETTNTITDPFTTAPR
GPKKAQPAQKKVGLTDSEQFQMQMQQEQQENAVQAPTDESKMSLAPHEYKPVQTTESDNT
SAASGFVKFGSGSIQDIQVILKKYHLSLANQQFKISKEITSTVIPKLEELRKDLRYKITE
IKDLHGDFKTNIGAHIQLTSQLLKKYIAAVKFMNAHGIGNDRASPTNKKPHKLDPKHDPY
LLKLQLDLQLKRQVAEETYLQEAFINLQSSGLQLEKIIYTKIQHALLRYSALIDSEARLM
IKNMCQELQHGIISKPPAFEWDNFVTQHPSCLLNWKSNDPIPPPRKVSDVIYPHMKSPLA
KCIKAGYFLKKSELLPTYHQGYFVLTSNYIHEFQSSDFYNLSSSTPNSTKSSAYSSSVSI
ADTYANANNAKANNHHRQASDVHNSSTTTGGTAGANGIRGIRKKSYLAPIMSIPLNDCTL
KDASSTKFVLVGKPTLNENADVRKSSSSTYLSGSSQASLPKYGHETAKIFSKAPFHKFLK
GSKPKNKNTKSSELDQFYAAAQKESNNYVTWTFKIVSPEPSEEELKHFKRWVQDLKNLTS
FNDTKDRIKFIEDRVMKSHRFKAGHMSRNSVNIGSHTPCLTDSTFTLQDGTTTSVNLKGR
AEKPQYIHIQNNSLADFDGNGFRSKVNTPAIDDYGNLITVERRPAQSPHQYSDYMATSGN
TTPSYSSGSRPQSMYNGYNPAVSITSNGMMLQPSTANNNTNPTTNLRHQRNISQTSSLPG
FSYTSLSLPVNSPGSSNSESSSGGYFAIPLHGNNNNNNYTQRNSEGSSPCYNDDQIRQQQ
QPLQMQPLSRTSSSSVNVTAMRSTSAGNSITANAPVVPKVMVNNQNVKTVAADQSATAPS
SPTMNSSVTTINRESPYQTLKKTNSTGNVPCLTAEKTHAHPAFYKRGNNSAQNLTTSSST
ASRVHPIRKHKKNVSFSSLNSLMFSKKGANHGGNLMTNQFMSGGIQEDDGDSTNNDTIKL
NQSIYS
Download sequence
Identical sequences A0A0L8VQ45 B3LIC9
YGR097W SCRT_00920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]