SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LK61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LK61
Domain Number 1 Region: 454-624
Classification Level Classification E-value
Superfamily Sec7 domain 9.16e-43
Family Sec7 domain 0.00037
Further Details:      
 
Weak hits

Sequence:  B3LK61
Domain Number - Region: 1031-1069
Classification Level Classification E-value
Superfamily PH domain-like 0.0616
Family Pleckstrin-homology domain (PH domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3LK61
Sequence length 1226
Comment (tr|B3LK61|B3LK61_YEAS1) Uncharacterized protein {ECO:0000313|EMBL:EDV11289.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_02574 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNQSISSLIKLKFLQSHSNDKNGNKKGGSNVSTGIDKLRESESYRSPFLQLAEIQEHTNN
DDDKLDVKECEPTKKHSKLSRIRRKMGRLDLNFRSANEKGSEDDEILVAQHLRNGQDPEE
MPFKSENNIDSIEKVPKPDGERVTLTGSGSDNVKRNSKHAPFIPVKPALEKFPSSNRLSR
DYRKSQEPTLFNGDRLVPTLPTVSRISTSSSVGSSTAASRYFNPSKRAVVASSSSSSSSI
KFNSLHAIPLDATPQIELAKQQDEISKRRFGRRRSRTVDVFDYINKNNTAKNKPPLSPSS
FIRTIDEKNTNSLMQDPMGSRGPLLPDDANIISNDTDGAEASHPDHQVLSRSRSQSTSFV
QGKGGKRKSIEDEGYHNKLGLPHGSGPTSVYNNKSNANSTITGMSRRSSSIVNALSSFVN
LRSSSLSSSRQQHLQQQQQLQQKLDVSLEDLPPVPAPEFSDSCKDFLIKLAPYGKFIGII
LTEKDDEFKKNCLNYLLTNCFEFKNDPLDIALRKLLMFLELPKETQQIDRLIMAFSFAYY
KAQKSYSKKKGIECPWSNADQVYFIAFSLLMLHTDYFNPNNKSKMTKHDFVDLVHNDKYS
GGNEIPMAVLTYFYENVTAKESPKFNYFLMSPMALDDSILDKDAFDTNFAITLSSNSMYS
PIDMIKRGSIIPKEASLSPIFYPLTNSISASGIAPSTAASCPPSTSGTINGANLGTANSN
SNRPASNSISSYFSYNPSSSSSGNATLVQDDINVYSHIINDTLNEVNLFPEVSKYWNKNA
LKANLLRNEEHKYEKYYSIMNDTKGGYLRFHKSQLNKLNLPNFEILNDNSRSGCKNSDYK
YCKILQMGAIMNLGMPSRKFSIVNSAKIHWKKEFAILTSFGLLICDKMDWINPQMMKDPK
SGTTNYIIDFKSGFSFVPGSTIDVYNGLFADRERDSLGKSHFASLVLAYTEHHSTGSHTS
NTTAASSSAKHNEGVFEPSSDEEDSITNSTDGTSSVSNGESDNDSVSSSDNQLSSNDSNE
DYHSIKDEYPIFEDENADCLLYLHTCHRNFIWKCANKYERDNWIDSINLFSAYDGCYVEI
GSIANTICNKRKLTILQRMERLRSIKSAKWEKLKKFESTLMLMGKCVPISTKSKTDMINR
IRQLAVRMDWLIYEIKRSELFVSIIKEVTRKQAEKNILEHGKGEEEGQGNNDDSDGIDDI
EESFLFNENSLQVCVSDSSYDEYSNE
Download sequence
Identical sequences B3LK61
YPR095C SCRT_02574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]