SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LMA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LMA2
Domain Number 1 Region: 22-131
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-32
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 168-235
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 6.8e-18
Family DnaJ/Hsp40 cysteine-rich domain 0.00044
Further Details:      
 
Domain Number 3 Region: 285-371
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000536
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 
Domain Number 4 Region: 135-160,225-279
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000222
Family HSP40/DnaJ peptide-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3LMA2
Sequence length 377
Comment (tr|B3LMA2|B3LMA2_YEAS1) Uncharacterized protein {ECO:0000313|EMBL:EDV11705.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_02108 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MIPKLYIHLILSLLLLPLILAQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEE
AHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMF
QGGHGGPGGGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADG
KLAQCPDCQGRGVIIQVLRMGIMTQQIQQMCGRCGGTGQIIKNECKTCHGKKVTKKNKFF
HVDVPPGAPRNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSA
AEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGYGDLYIDYVV
VMPKTFKSGQNMLKDEL
Download sequence
Identical sequences A0A0L8VJC6 A0A250WEL3 A6ZMS6 B3LMA2 B5VPY1 C7GRD7 C8ZF78 E7KSY1 E7QIJ9 G2WKS1 P25303
YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W NP_013941.2.97178 YMR214W YMR214W SCRT_02108 4932.YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W YMR214W tr|A6ZMS6|A6ZMS6_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]