SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LNU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LNU4
Domain Number 1 Region: 3-109,148-246
Classification Level Classification E-value
Superfamily PIN domain-like 5.1e-31
Family 5' to 3' exonuclease catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3LNU4
Sequence length 830
Comment (tr|B3LNU4|B3LNU4_YEAS1) Retroviral protease signature protein {ECO:0000313|EMBL:EDV12339.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_03221 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAIKSLESFLFERGLVGSYAIEALNNCTLGIDVNHYVSRLLTNKREQYLDAIGGFPTSLK
MYLESDLKIFKDFNITPIFVFNGGLTYNQLEASGHFTAASASASISSTTTSSSGTNATTR
SNTESVLLQRSRGWTQWNNLISSNQNSYIDQPIQPQEPFRHNTTIDSKAYQNDLIAYFIE
HGYMYQVAPYSSWFQLAYLLNSAYIDAIYGPTDCLMLDCVDRFILGMEFPNKEFRFIDRS
RVMKDLGCTHEEFIDIAMAVGNDLQPTTLPPLQIYPVPQLFDIALEMVLNTGTNFYAYQL
STTLQNDSKENIQNYQRGISALRYMPVLKDTGKVELFVQEIVVSEEDSEKNNKDGKKSNL
SSPSSASSSASPATTVTKNASEKLTYEKSSTKEVRKPRDIPNDVHDFIGQMLPHEYYFYR
SIGLVTGKLFDAIVTGVYPEEPPLGGGSSTSYRKLVSKSVEIFKNKEINLLTQPINRYYQ
IKQIKQVKWYAANEPTTLTNRMSPSMFETINHLIVKTETSDEKEFSISEFITTINGSSNM
AKDFISEKVIFPNSVPIESKLNSPFNLLSTNFLRLLVLLEFFTFDFKEKLLEPTRWGEVF
LKLNELNIDSKYHESVIIFLVFLKCDVLKLDEEVQPPAPSALSQATLRSYPEESLYVLLI
TRVLTLFQVDQKPSNYHGPIDKKTLIFRDHLSFIKENLNELFEAVLISSLTSGEFNRLSL
DNFGWARKIVRYLPFKLDSPNTIMAMMWEFFLQKYLHNGNAKNDALSLVATEFNTYKSTP
NLDEQFVESHRFLLEISKVMQELNAAKLIDENVFKLFTKAVEFTTTALSS
Download sequence
Identical sequences A6ZRZ5 B3LNU4 C8ZGE5 H0GMK6 N1NXY4
YNL085W YNL085W YNL085W YNL085W YNL085W tr|A6ZRZ5|A6ZRZ5_YEAS7 SCRT_03222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]