SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LQH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LQH6
Domain Number 1 Region: 1295-1418
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000102
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3LQH6
Sequence length 1447
Comment (tr|B3LQH6|B3LQH6_YEAS1) Bud site selection protein BUD4 {ECO:0000313|EMBL:EDV12829.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_03741 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MHDAESTVDSLLKEIDNEMEQTKSNITQNGSEDTPHNWKLPLQEIGDGTMEMLVKHNTRS
NATENSRGRSPSKMSTISNESLNLGLLRVNSELEESPAAVHQERIKNSVANGALGHANSP
KVLNNLKNMAQDIDKLARDEEKPVKLSSSPLKFTLKSTQPLLSYPESPIHRSSIEIETNY
DDEDEEEEDAYTCLTQSPQILHSPSRIPITNAVSINKLNLDFTLNPNESDKSLVSDTSVD
STGRELDTKTIPELPFCMSSTPEMTPVDEKCNLPSKLLNTSNNSHSDSRSPTASVEDLNI
STNLPGADSSQNNPVTTDADALIENDVVRDLQQNMEHIDDAFDEKKVLDEGCSNEPVTFL
GENDTRSIVYSNKGTNANVQEFSQEDSLAHSEPNFKDLNATSDDVWNEDKETDANISTST
KSEESYIADYKVTRQEDWDTKKLHQESEHANEQPAIIPQKDSSEETFTELNNESEFQRNS
KDGEEYRIVQHEESLYGQRTKSSEENIINGSEIGVDHGEAAEVNEPLAKTSAEEHDLSSS
CEDQSVSEARNKDSIEEKEVETKDENIETEKDESEYHKVEENEESEHVPLLPPLPRWEEI
QFNEPFIDENDTSNDSIDLTRSMKPSDYISIWHIQEEEIKSNSPESIANSQFSQQSSITT
ASTVDSKKDNGSTSFKFKPRIVSRSRIYNPKSRVSSLNYYDNEDYILSNSEWNALDPMRR
NTLISKRIQDNIRTQKGHAPLIRPSVMKLNGEDSGFQNHFLEVEQPQEHENIPLSTHLSE
QDITTNVGPDEQKLPTNTQDEAEISIREIESAGDITFNRGDLLSLSFDEELGQDFANFLD
ALDHDSTSFNHGPDDSSSFQRDSSKKSFNSLWESSYELKPPPSIRKQPIAPDVLQKLLES
DTKDDADLEKIREERITEPRTGLGIGMLKTPVKDVSIALAASIKGYEASFSDTDSRPEGM
NNSDAITLNMFDDFEEDKMTPSTPVRSISPIKRHVSSPFKVVKAGNKQENNEINIKAEEE
IEPMTQQETDGLKQDIPPLLAQTKDNVEAKEETITQLEEPQDVEQEFPDMGTLYLSIKAI
STLALYGTKSHRATYAIVFDNGENVVQTPWESLPYDGNIRINKEFELPIDFKGKAETSSA
SSERDSYKKCVITLKCKYEKPRHELVEIVDKVPVGKSFFGKTKYKFEKKYVQKKPKQDEW
DYLFAQDGSFARCEIEINEEFLKNVAFNTSHMRYNMINKWSRIADKIHGSKRLYELPRKA
PHKVASLDVEACFLERTSAFEQFPKQFSLVNKIVSKYKLQQNIHKEGYLLQDGGDLKGKI
ENRFFKLHGSQLSGYHEISRKAKIDINLLKVTKVLRNEDIQADNGEQRNFTDWVLFNECF
QLVFDDGERITFNAECSNEEKSDWYNKLQEVVELNVFHQPWVKKYCEKLAEEEKTRTTGH
NLKQDFN
Download sequence
Identical sequences B3LQH6 C8ZBN8 E7LWG4
YJR092W YJR092W SCRT_03742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]