SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3Q770 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3Q770
Domain Number 1 Region: 27-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-73
Family Atu2684-like 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3Q770
Sequence length 251
Comment (tr|B3Q770|B3Q770_RHOPT) Uncharacterized protein {ECO:0000313|EMBL:ACE98758.1} KW=Complete proteome OX=395960 OS=Rhodopseudomonas palustris (strain TIE-1). GN=Rpal_0198 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSCPPADRIIGELARDPS
VIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTPQVVVNGSAHLVGSNRA
GIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGETAKSGEVWICAVSKAIPIEI
GRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGDGVDAAAVYVQNGSREKPG
AMLGAAFTSLN
Download sequence
Identical sequences B3Q770
gi|192288629|ref|YP_001989234.1| 395960.Rpal_0198 WP_012493976.1.13849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]