SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3RHN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3RHN3
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.91e-16
Family Thioltransferase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3RHN3
Sequence length 109
Comment (tr|B3RHN3|B3RHN3_YEAS1) Uncharacterized protein {ECO:0000313|EMBL:EDV08677.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_04308 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSAFVTKAEEMIKSHPYFQLSASWCPDCVYANSIWNKLNVQDKVFVFDIGSLPRNEQEKW
RIAFQKVVGSRNLPTIVVNGKFWGTESQLHRFEAKGTLEEELTKIGLLP
Download sequence
Identical sequences A0A250WK49 A7A1P3 B3RHN3 C7GRW0 C8ZDX3 E7KFX5 E7KS30 E7LY01 E7NL06 E7Q795 E7QIG6 G2WJI3 H0GKQ1 N1P791 Q05926
YLR364W 001288952|e2m80A1|2485.1.1.222|A:9-117 d2m80a_ YLR364W YLR364W YLR364W YLR364W YLR364W YLR364W YLR364W SCRT_04309 YLR364W YLR364W YLR364W NP_013468.3.97178 YLR364W YLR364W YLR364W YLR364W 4932.YLR364W YLR364W YLR364W YLR364W 354938 YLR364W tr|A7A1P3|A7A1P3_YEAS7 YLR364W YLR364W YLR364W YLR364W YLR364W YLR364W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]