SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3RHN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3RHN8
Domain Number 1 Region: 638-866
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-48
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 427-505
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000098
Family DEP domain 0.032
Further Details:      
 
Domain Number 3 Region: 877-949
Classification Level Classification E-value
Superfamily PH domain-like 0.0000689
Family Pleckstrin-homology domain (PH domain) 0.046
Further Details:      
 
Weak hits

Sequence:  B3RHN8
Domain Number - Region: 1031-1073,1124-1219
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0165
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3RHN8
Sequence length 1355
Comment (tr|B3RHN8|B3RHN8_YEAS1) RHO1 GDP-GTP exchange protein 2 {ECO:0000313|EMBL:EDV08682.1} KW=Complete proteome OX=285006 OS=Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast). GN=SCRG_04313 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSKTNVDSLGDRNDIYSQIFGVERRPDSFATFDSDSHGDISSQLLPNRIENIQNLNVLLS
EDIANDIIIAKQRRRSGVEAAIDDSDIPNNEMKGKSSNYILSQQTNIKEVPDTQSLSSAD
NTPVSSPKKARDATSSHPIVHAKSMSHIYSTSNSASRQAKHYNDHPLPPMSPRNEVYQKN
KSTTAFVPKRKPSLPQLALAGLKKQSSFSTGSASTTPTQARKSPLQGFGFFSRPSSKDLH
EQHQHHQHIQHNNINNHNNNNTNNNGAHYQVGSSNSNYPQHSHSISSRSMSLNSSTLKNI
ASSFQSKTSNSRKATQKYDITSNPFSDPHHHHHHHSSNSHSSLNNVHGSGNSSSVMGSSS
NIGLGLKTRVSSTSLALKRYTSVSGTSLSSPRRSSMTPLSAPRPVMSASSKKPQVYPALL
SRVATKFKSSIQLGEHKKDGLVYRDAFTGQQAVDVICAIIRTSDRNLALLFGRSLDAQKL
FHDVVYEHRLRDSPHEVYEFTDNSRFTGTGSTNAHDPLMLLPNSSSFNSGNHSYPNSGMV
PSSSTSSLNSDQATLTGSRLHMSSSLSQQKNPAAIHNVNGVFTLLAECYSPTCTRDALCY
SISCPRRLEQQARLNLKPNGGLKRNISMALDDDDEEKPSWTSSVSKEDWENLPKKEIKRQ
EAIYEVYITEKNFVKSLEITRDTFMKTLAETNIISADIRKNFIKHVFAHINDIYSVNRRF
LKALTDRQRSSPVVRGIGDIVLRFIPFFEPFVSYVASRPYAKYLIETQRSVNPYFARFDD
DMMSSSLRHGIDSFLSQGVSRPGRYMLLVKEIMKSTDPEKDKSDYEDLSKAMDALRDFMK
RIDQASGAAQDRHDVKLLKQKILFKNEYVNLGLNDERRKIKHEGILSRKELSKSDGTVVG
DIQFYLLDNMLLFLKAKAVNKWHQHKVFQRPIPLPLLFACPGEDMPALRKYIGDHPDCSG
TVIQPEYNTSNPKNAITFLYYGAKQRYQVTLYAAQYAGLQTLLEKIRQGQAAIISKTEMF
NVTKMSDRFFDYTNKINSVTSCDGGRKLLIATNSGLYMSNIKRQQNKDHRHKSSAFFSTP
IQLVQRNNITQIAVLEEFKSIILLIDKKLYSCPLSLIEAEGNGTSFFKKHHKELINHVSF
FAEGDCNGKRLIVTAHSSSHSIKYFEHEHPLLAEKNGSGSGNKKSLKKKITEVIFDSEPV
SISFLKANLCIGCKKGFQIVSISQNAHESLLDPADTSLEFALRDTLKPMAIYRVGNMFLL
CYTEFAFFVNNQGWRKKESHIIHWEGEPQKFAIWYPYILAFDSNFIEIRKIETGELIRCV
LADKIRLLQTSTQEILYCYEDYRGYDTVASLDFWG
Download sequence
Identical sequences B3RHN8
YLR371W SCRT_04314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]