SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3RTG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3RTG8
Domain Number 1 Region: 27-133
Classification Level Classification E-value
Superfamily PH domain-like 2.99e-30
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 200-296
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000641
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3RTG8
Sequence length 406
Comment (tr|B3RTG8|B3RTG8_TRIAD) Uncharacterized protein {ECO:0000313|EMBL:EDV27225.1} KW=Complete proteome; Reference proteome OX=10228 OS=Trichoplax adhaerens (Trichoplax reptans). GN=TRIADDRAFT_54960 OC=Eukaryota; Metazoa; Placozoa; Trichoplax.
Sequence
MPPATNRNIPSKILTEEENRVIFDILASQKCTTLATTVVQVQLAQPNPSSWTKKCTGVLC
LVKDYAVKSYFLRVYSPVGKTLLWEQEIYLNFQYKKSTEYFHTFQAHDCTAGFNFADTDE
AASFYLTLTNKLKLKKEKNATVSRSKQKNKHQQPISNKPLDTYVRKDSAQVKSLNLSHNK
RRPRDKGGKKLTKLDISQPTEFRHLKHVGWDENSKSLVEEVSEEWKDLYSSIGLTTADLH
DENIMQMVHKVVEQRGGIEKANKEITLRRQRPSLSRPSLPPVHGSPAPCPPPPPCLPSLP
GPIPIPIPASLPPYSSSRSPSPPLPSPPPLPVPPVSEPRESLFDQIHRGIELRKVHNTEE
MKKKAPPLAEESSIITALDKELARMNPRVQRSDSESSDGSDWDDMD
Download sequence
Identical sequences B3RTG8
10228.JGI54960 XP_002111221.1.101920 jgi|Triad1|54960|fgeneshTA2_pg.C_scaffold_3000967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]