SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3RV64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3RV64
Domain Number 1 Region: 289-454,494-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-53
Family Tandem AAA-ATPase domain 0.00075
Further Details:      
 
Domain Number 2 Region: 88-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-32
Family SPRY domain 0.013
Further Details:      
 
Domain Number 3 Region: 4-69
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000377
Family Tandem AAA-ATPase domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3RV64
Sequence length 734
Comment (tr|B3RV64|B3RV64_TRIAD) Uncharacterized protein {ECO:0000313|EMBL:EDV25940.1} KW=Complete proteome; Reference proteome OX=10228 OS=Trichoplax adhaerens (Trichoplax reptans). GN=TRIADDRAFT_24752 OC=Eukaryota; Metazoa; Placozoa; Trichoplax.
Sequence
MSPFRSYIELGVMPEIVEATEEMDWILPTNIQAEAIPLILGGGDVLMAAETGSGKTGAFC
LPVIQIVHEALTETVKGKPLKSSVKPSIDTKVKLNPFDRSDQLAIDKDGLICQGREHFQW
LGCRSNIGVVKGKFYYEATVTDEGLCRVGWSTDIASLDLGTDNNGFGFGGTGKKSYARQF
DGYGEPFGHKDVIGCMLDLDNYEIRFSKNGVDFGRAFEIPQKLRNSPFFAAVVLKNAEMQ
FNFGDDAFTFSPPQGFRTLSKSTTDERYHNIKGPNSSSKESRRPTHSAPTALIIEPSREL
AQQTCDQISLFKEHLASPAIREVLLVGGENPKQQVNLLREGVEMVVGTPGRLDDFISSKK
LDLSQVRFYILDEVDGLLAQGHSELICQIYNKLPKVSTDGKRLQIIVCSATLHNEAVKQL
ADKIMKYPTWIDLKGKDSVPDTVHHVVCMIDPTKDKGWLNLRRDITTDKVHANDLIKSTS
TTPETLSEAIKTLKVHYLVKAINALNMEQAIIFCRTKLDCDNIEKHLIELGGGPRAMVNQ
LSCVCLHSDRNRAERQQNLSSFKCGQIRFLICTDVAARGLDITGIPYVVNVTLPDEKENY
IHRIGRVGRADRMGLAISLISTVPEKVWYHTCPSRGKKCHNTKLKENGGCTIWYDEVQLL
KNVENHLNTKVATVNSDFVVEKTVSGEKIVYGGKKSETGENKGHFEQLASTVSELATLEK
QVQLSFLSMQFNRR
Download sequence
Identical sequences B3RV64
XP_002111973.1.101920 10228.JGI24752 jgi|Triad1|24752|e_gw1.4.808.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]