SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3Y629 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3Y629
Domain Number 1 Region: 294-620
Classification Level Classification E-value
Superfamily L domain-like 2.38e-38
Family Internalin LRR domain 0.088
Further Details:      
 
Domain Number 2 Region: 670-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.35e-37
Family Toll/Interleukin receptor TIR domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 32-253
Classification Level Classification E-value
Superfamily L domain-like 1.16e-33
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3Y629
Sequence length 839
Comment (tr|B3Y629|B3Y629_9PRIM) Toll-like receptor 4 {ECO:0000313|EMBL:BAG55038.1} OX=9593 OS=Gorilla gorilla (western gorilla). GN=TLR4 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEYL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMTFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVRRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLRVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENVYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
Download sequence
Identical sequences B3Y629 G3RY19
ENSGGOP00000020706 ENSGGOP00000021036 ENSGGOP00000020706 ENSGGOP00000021036 NP_001266512.1.27298 XP_004048562.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]