SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3Y669 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3Y669
Domain Number 1 Region: 630-776
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.89e-42
Family Toll/Interleukin receptor TIR domain 0.000000422
Further Details:      
 
Domain Number 2 Region: 32-165,348-566
Classification Level Classification E-value
Superfamily L domain-like 1.22e-40
Family Ngr ectodomain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3Y669
Sequence length 811
Comment (tr|B3Y669|B3Y669_PANTR) Toll-like receptor 10 {ECO:0000313|EMBL:BAG55078.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0051790 OC=Catarrhini; Hominidae; Pan.
Sequence
MRLIRNIYIFCSIVMTVEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLSHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSILLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNKIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSILNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVS
ATREMYELQTFTELNEESRGSTISLMRTDCL
Download sequence
Identical sequences B3Y669 D7NVV0
9598.ENSPTRP00000027515 ENSPTRP00000027515 ENSPTRP00000027515 NP_001123936.1.37143 XP_009445751.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]