SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4EMH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4EMH8
Domain Number 1 Region: 194-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-22
Family SPRY domain 0.013
Further Details:      
 
Weak hits

Sequence:  B4EMH8
Domain Number - Region: 418-464
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 0.0389
Family MurCDEF 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4EMH8
Sequence length 526
Comment (tr|B4EMH8|B4EMH8_BURCJ) Hypothetical phage protein {ECO:0000313|EMBL:CAR55774.1} KW=Complete proteome; Reference proteome OX=216591 OS=/ NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315)). GN=BCAM1913 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MADLKMNQFPDGQLSDTQMLVGYDPYAAASGERKYSGVNLVSYLTGALPFIGNSNPTING
ILTLNGDIHFSGGAIVTSLGDMYQVARGKWLSADMAKLDDAWNKASAAQSAADQAAISVA
QAATSASSASANAATASSAASTATQAQTSATGSATAAQAWASQPTGTVQGTSSYSSLYYA
GQSQYWAGISQAMVAAPTTFDPGYKHSSITLSNGNLTATFAGSQAVVLGTIGYATGKHYF
EITFASGSSSGNASVGIAPSNEPLDSQIGYDDNSGAVGAFQTSGNVYLNGSKVASVSGYG
NANDVIGVAVDADRKLVWFRSNSGEWNASGTADPASGTGGIAYTQTGKMFPAVCTDSSAV
FTANFSGNFKATIPTGFKAWAADAFHYVVPYATTSTPGIVVAGSGVSVDPYGKLSVDTYY
DMVSIQAQDTISIDLTAPVPGYHIVLNSQAATFALTNLQLPAGKALRLTFYFEQGTGNNT
ISSWDSRIKWVGSRPILAYTVGSRNVIELETIDGQTFAGYYIGQIN
Download sequence
Identical sequences B4EMH8
gi|206563763|ref|YP_002234526.1| 216591.BCAM1913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]