SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4F902 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4F902
Domain Number 1 Region: 380-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-72
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 61-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-63
Family Legume lectins 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4F902
Sequence length 755
Comment (tr|B4F902|B4F902_MAIZE) L-type lectin-domain containing receptor kinase IX.1 {ECO:0000313|EMBL:AQK38716.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d023253 OC=Zea.
Sequence
MLQRWRPAGRPSGLTTVSRGIYCLCTLLLLLLPSIHVPRARSLSFDLSFSKPQSPGLSQL
VNCTGDAYITPDTLELTRNRRDQSSTYSLGRATYMHPVPLWDARTGETASFTTTFSFLIS
RDPSTFPGDGMAFFLGHFGSSIPTNSSGGMLGLMPAFTNGTGDGTVVAVEFDTFLNHAND
DISGSHVGIDVNSLNSTAATDTSSTRNLTSGYEMVATVSYENVTRFLAVQLTIYDTSYNV
NATVDLKSYLPERVAVGFSAATGKGGEQHQVLSWSFTSTLQEAPAPAPAPPPRALTPGSS
TQQPKKTSSEGTLVVAVLVPLLSLLLACAAAAVLVWWKRRRRRRSSGGIGTSDDDDDDNG
HRDQDGSRAELERGVAASGPRRYAYRDLAAATNYFAEDGKLGRGGFGSVYKGNLVVAGEA
RPVAIKVFSSESSAQGRKEFEAEVRIISRLKHRNLVQLLGWCDSRHGLLLVYELVAQGSL
DRHLHSSSGDSGSESPFLAWPERYRIILGLGSALRYLHQEWEQRVVHGDIKPSNIMLDDA
LSAKLGDFGLARLGDHGGRWHTTNAVLGTAGYIDPEFVNTRHPSTHSDVYSFGIVLLEVV
SGRAPVVLRQDEPPFVLLKWVWGLYGRNAILDAADQRLRTGDGLRHDQCMERVLVVGLWC
AHPDQSERPSIAQAMHILQAEDARLPPLPPQMYKTASDLAVSGRAYGALSVESYSGGSFT
TTTATTMTTTTTSSDSKISRGLSTTALLRDSKERA
Download sequence
Identical sequences B4F902
GRMZM2G104655_T01|PACid:20873250 NP_001130397.1.34533 GRMZM2G104655_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]