SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4G162 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4G162
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.54e-40
Family PAPS reductase-like 0.0042
Further Details:      
 
Domain Number 2 Region: 249-358
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-22
Family PDI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4G162
Sequence length 360
Comment (tr|B4G162|B4G162_MAIZE) Uncharacterized protein {ECO:0000313|EMBL:ACF88105.1} OX=4577 OS=Zea mays (Maize). GN= OC=Zea.
Sequence
MDRALAMFGSEIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDKVEKHY
GIRIEYMFPDASEVQELVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKD
QSPGTRASIPLVQVDPSFEGLDGGAGSLVKWNPVANVDGKDIWTFLRTMDVPVNTLHAQG
YVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDKDAQAAAPRSANGNGSAG
APDIFESPAVVSLTRTGIENLLRLENRAEPWLVVLYAPWCPFCQAMEASYVELAEKLAGS
GVKVAKFRADGEQKPFAQAELQLQSFPTVLLFPGRTARPIKYPSEKRDVDSLLAFVNSLR
Download sequence
Identical sequences B4G162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]