SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4GDY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4GDY7
Domain Number 1 Region: 12-157
Classification Level Classification E-value
Superfamily DEATH domain 2.98e-58
Family DEATH domain, DD 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4GDY7
Sequence length 449
Comment (tr|B4GDY7|B4GDY7_DROPE) GL21462 {ECO:0000313|EMBL:EDW34648.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL21462 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAKANGWCGSSSKYTRTTELRRVEDNDIYKLATILDVNACWRKLMSIIPKGLDVQACSAA
GAVKITANGGPKYTAQDISLIDGVAERLPPDQSISQVMIDEWKTSGKLNERPTVGVLLQL
LVEAELFSAADFVALNFLNEPKPERPADGPAAHFSLELGDDMDVDTEATDASYLPNTAAL
NAAAQGSLGFNLDYFDKHMVRRDKSVPQPSASVPPTAPPRSSRHQKNTASPSASTGSTSA
TATTPNIPNLTILNPSEQLQEPAQVEQPPPQNIPNLSILINSSAASMTTASTALENTSNG
SSSTDPPNIPIITLLIDNPAEISGPVAADAVSANSTTTPTAASLNNLPMISALNLNAENG
EAFHQDSGSTSSLSNDEDDDDDIDEEGDYADASLPNLSNSEQHNSNNDSSLTTVTGTSGD
NSFELTNDSSSASNDDYASNIPNLSELQQ
Download sequence
Identical sequences B4GDY7
XP_002017548.1.64850 FBpp0185569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]