SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4H3U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4H3U8
Domain Number 1 Region: 938-1105
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.26e-44
Family Lysophospholipase 0.087
Further Details:      
 
Domain Number 2 Region: 170-307
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-22
Family cAMP-binding domain 0.016
Further Details:      
 
Domain Number 3 Region: 613-723
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.23e-21
Family cAMP-binding domain 0.0085
Further Details:      
 
Domain Number 4 Region: 1108-1228
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.99e-16
Family Lysophospholipase 0.072
Further Details:      
 
Domain Number 5 Region: 476-607
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000196
Family cAMP-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4H3U8
Sequence length 1435
Comment (sp|B4H3U8|SWS_DROPE) Swiss cheese {ECO:0000250|UniProtKB:Q9U969} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=sws OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDVLELLRVSGSNMYYSTFLADAWCYYISNQITMTMYLYCALGVLSMLFIGWFVYFKRLA
RLRLRHEIARSLSAVTMASGGDLRGPRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYK
RRAVIRFARRILQLRRENMPLEVRTVEPPAEYLEETMEGSDRVPPDALYMLQSIRIFGHF
EKPIFLRLCKHTQLLELMGGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRK
GESVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMAAFQEVFKDSPDVMIRVIQVI
MIRLQRVLFTALRNYLGLNAELVQNHMRFKGSSQGAGPSVYCSQTTRQATGSASATATAA
AASGTAGSTHTAVPRPASSLSRYSQDEQHTLSDPNPGIPNLELSGDSVNTLFGEVNGGAR
LNSYPPLYHQRESDGNLSTRRGSITQQEQPEVGPVPSIDMRLVKSSAVDSLRKELGLPEQ
DAHIIDPFVEVREMEPNVTLITEGNADDVCVWFVMTGTLAVYQGNADATRIKQDKTDLLI
HYVHPGEIVGGLAMLTGEASAYTIRSRNHSRVAFIRRAAIYQIMRQRPRIVLDLGNGVVR
RLSPLVRQCDYALDWIFLESGRALYRQDESSDSTYIVLSGRMRSVITHPGGKKEIVGEYG
KGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKLISFLSHRFLG
SMQTRTTTGAPGAPVEANPVTHKYSTVALVPITDDVPLTPFTYELYHSLCAIGPVLRLTS
DLARKQLGMNIFDASNEYRLTSWLAQQEDRNIITLYQCDNALSPWTQRCMRQADVVLIVG
LGDHSHLVGKFEREIDRLALRTQKELVLLYPETASSKPANTLSWLNARPWVTKHHHVLCV
KRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGGARGAAHIGML
KAIQEAGIPIDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWFLQLLDLTYPI
TSMFSGREFNKTIHETFGDVNIEDLWIPYFTLTTDITASCHRIHTNGSLWRYVRSSMSLS
GYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMSIAGVFPPFCDYRDGHLLLDGCYT
NNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFTAPVKVPDLPD
IQSRLAYVSCVRQLEEVKNSDYCEYIRPLINKYQTLSCAGCPETYGLNPSDLFSEDEDCD
GYISEPTTLNTDVRRYQVPRGGNSLSLSETEMDMDSDVEMDLKMERKMDKATQSTPPLQS
KAQILRRKHSKEEARHEWEIKREQKQELAREQELERERELSQKGTTAGATGYTPNAVIAT
QTSLIFMDEEDEMDKKKTKDNDRDEVRGSAEDTGKEKEEDKENRSNTNNETKNYL
Download sequence
Identical sequences B4H3U8
XP_002025527.1.64850 FBpp0179350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]