SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4HE07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4HE07
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.75e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000114
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.58e-19
Family Cold shock DNA-binding domain-like 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4HE07
Sequence length 173
Comment (tr|B4HE07|B4HE07_DROSE) GM25797 {ECO:0000313|EMBL:EDW42099.1} KW=Complete proteome; Reference proteome OX=7238 OS=Drosophila sechellia (Fruit fly). GN=Dsec_GM25797 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFC
PNGNPPCYKSKDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN
Download sequence
Identical sequences B4HE07 B4QZ40 Q9VFB5
FBpp0082591 FBpp0218776 FBpp0207274 NP_731983.1.81976 XP_002031113.1.34323 XP_002103365.1.80810 FBpp0082591 FBpp0082591 7227.FBpp0082591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]