SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4IJC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4IJC0
Domain Number 1 Region: 152-320
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-37
Family Phosphotyrosine-binding domain (PTB) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4IJC0
Sequence length 328
Comment (tr|B4IJC0|B4IJC0_DROSE) GM17773 {ECO:0000313|EMBL:EDW51111.1} KW=Complete proteome; Reference proteome OX=7238 OS=Drosophila sechellia (Fruit fly). GN=Dsec_GM17773 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKTKKFIDYFCIFYLLSNNLEEYVADIPFAGLFKGSTLNLSSDVVDGIGAVPGDREFLQS
PSMVRSAHVQNHRRSLSKQRYSALGEDFSASRVWAEIDTIFENIGNEVSTVEQEVEELVE
DPASLSLADSRQSLHIRDPAELLLGRKPSAASSNWCHSPYTLIYGEIRYSLFYLGSTVIR
KLQGTLSTRKSIQKLKIDENLKSAASVSDFSLLENCTTSTKYLKAANHQTRLNVDIAVSC
VGVKFIDHEKKTAICCHDIENINCVSQDSEDLRYFAYITKEQDLHYCHVFMVDSLELAKE
IIMTLGQAFEVAYQLALSRQGTSLNEEC
Download sequence
Identical sequences B4IJC0
XP_002043830.1.34323 FBpp0199250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]