SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4ISV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4ISV9
Domain Number 1 Region: 104-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-67
Family SPRY domain 0.00000000108
Further Details:      
 
Weak hits

Sequence:  B4ISV9
Domain Number - Region: 307-347
Classification Level Classification E-value
Superfamily SOCS box-like 0.000262
Family SOCS box-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4ISV9
Sequence length 349
Comment (tr|B4ISV9|B4ISV9_DROYA) Gus, isoform A {ECO:0000313|EMBL:EDW99541.1} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=Dyak_GE11348 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEFGKKRYKGGRTPSIRSSERRRPQSVSSISTLSPRVVLSRLEPREFERLRLSYKVAIDQ
RRSRSCRGMNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASR
DLQLRHSWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQ
RGTHAVVGVCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKND
EAFLVPDKFLVALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPVVSAVWGHCEITMRYIG
GLDPEPLPLMDLCRRTIRQKIGRTNLEERIQQLQLPLSMKTYLLYKNRR
Download sequence
Identical sequences B4ISV9
FBpp0256358 7245.FBpp0256358 XP_002086071.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]